A practical reference on redox status: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2025-10-12. Anything still debated is marked as such rather than presented as settled.
Measuring glutathione requires attention to sample preparation because the molecule oxidizes readily. Blood, tissue, and cell samples are often treated with acid to precipitate proteins and stabilize the thiol. Without such steps, GSH can convert to GSSG or form mixed disulfides during storage. Analytical methods include spectrophotometric assays, high-performance liquid chromatography, and mass spectrometry. Each approach has different sensitivity, specificity, and susceptibility to interference from related compounds in complex matrices.
For solid glutathione, storage conditions affect shelf life. The reduced form is typically kept cool, dry, and protected from air and light. Moisture can promote oxidation, while elevated temperatures accelerate degradation. Suppliers often specify storage at or below freezing, sometimes under inert gas. Solutions are less stable than powders and may require preparation shortly before use. Buffers and chelating agents can slow oxidation, but they do not eliminate it. Published stability data vary with matrix, pH, and container.
Quantification of glutathione in biological or food samples commonly uses liquid chromatography coupled to ultraviolet, fluorescence, electrochemical, or mass spectrometric detection. Because the thiol group oxidizes readily, samples are often acidified or derivatized immediately after collection to stabilize reduced glutathione. Enzymatic recycling assays and colorimetric kits offer higher throughput but generally lower specificity than chromatographic methods. Mass spectrometry can distinguish glutathione from related thiols and allow simultaneous measurement of oxidized forms. Reported concentrations depend strongly on sample type, extraction procedure, and analytical platform.
Glutathione reference materials are sensitive to oxygen, light, and elevated temperature. Solid material is typically stored desiccated at -20 °C or below, while solutions require tighter control because thiol oxidation proceeds faster in liquid form. Aqueous solutions are often prepared fresh, kept cold, and protected from air; some protocols add acid or chelating agents to slow metal-catalyzed oxidation. Repeated freeze-thaw cycles can accelerate degradation and should be avoided. Stability data vary by matrix, so laboratories usually verify performance with their own storage conditions.
Quality control for glutathione measurements includes calibration with authenticated standards, internal standards where available, blank correction, and spike recovery checks. Because glutathione can form during sample processing or degrade before analysis, pre-analytical handling is a major source of variability. Interlaboratory comparisons often show differences in reported values due to method-specific calibration and detection principles. Interpretive thresholds are context-dependent, and no single reference range applies across all tissues or matrices. Researchers generally report both reduced and oxidized forms, along with the method and sample handling details.
| Property | Value | Notes |
|---|---|---|
| Typical assay | HPLC-UV or LC-MS/MS | Derivatization may improve detection |
| Storage temperature | -20 °C or below | Keep desiccated and protected from light |
| Appearance | White to off-white crystalline powder | Reduced form |
| Solubility | Freely soluble in water | Insoluble in lipids and nonpolar solvents |
| Common synonyms | L-Glutathione; GSH | GSH denotes reduced form |
Several techniques are used for quantification. Enzymatic recycling assays rely on glutathione reductase and a colorimetric or fluorescent readout, offering sensitivity for total glutathione. High-performance liquid chromatography can separate GSH from GSSG and other thiols, often with UV, fluorescence, or electrochemical detection. Mass spectrometry provides structural confirmation and can quantify low-abundance species when paired with separation. Each approach has trade-offs in specificity, throughput, and equipment requirements, so method selection depends on the research question and available instrumentation.
Stability depends on pH, temperature, oxygen exposure, and trace metals. Aqueous solutions of reduced glutathione are susceptible to oxidation, especially when neutral or alkaline and exposed to air. Transition metal ions can catalyze thiol oxidation, so chelators and inert atmospheres are sometimes used in research settings. Standards are typically stored cold and desiccated, with limited freeze-thaw cycles. Questions remain about how closely in vitro stability data reflect the behavior of glutathione within intact cells and tissues.
Glutathione serves as a cofactor for several enzymes, including glutathione peroxidase and glutathione S-transferase. These enzymes help reduce hydrogen peroxide and lipid peroxides, and they conjugate reactive electrophiles for excretion. The molecule also acts as a reservoir for cysteine, an amino acid that is prone to oxidation. In addition, glutathione participates in the metabolism of nitric oxide, leukotrienes, and prostaglandins. Its roles extend to cell signaling, apoptosis, and the regulation of protein function through S-glutathionylation.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine, and it is the most abundant non-protein thiol in most living cells. The reduced form, GSH, carries a sulfhydryl group that can donate electrons, while the oxidized form, GSSG, forms when two GSH molecules link via a disulfide bond. The balance between these two forms helps define the cellular redox environment, and their ratio is often used as an indicator of oxidative stress. Because the sulfhydryl group is reactive, glutathione participates in many cellular processes, including detoxification and protein regulation.
Glutathione is synthesized in two ATP-dependent steps. First, gamma-glutamylcysteine synthetase links glutamate and cysteine; second, glutathione synthetase adds glycine to form the complete tripeptide. The pathway is feedback-inhibited by GSH itself, which helps maintain steady intracellular levels. Tissues vary widely in glutathione content, with the liver typically containing the highest concentrations, followed by the kidneys, lungs, and erythrocytes. Because cysteine is often limiting, its availability influences synthesis rates, and regulation of this pathway varies by cell type.
In living systems, glutathione occurs in millimolar concentrations in many cell types, while extracellular levels are generally much lower. The liver holds a substantial share of the body's total pool, and the molecule participates in reduction, detoxification, and amino acid transport. It also serves as a cofactor for enzymes such as glutathione peroxidase and glutathione S-transferase. Because the cysteine residue supplies a reactive thiol, glutathione can donate electrons and become oxidized. Cells regenerate reduced glutathione through glutathione reductase using NADPH.
Commercial glutathione is produced by microbial fermentation or chemical synthesis, then purified. Reduced and oxidized grades are offered separately, with purity specifications often exceeding 98 percent. The compound appears in foods such as fresh fruits, vegetables, and meats, although cooking and processing can lower amounts. Oral, topical, and inhaled forms are discussed in research and consumer contexts, but absorption and tissue delivery remain active areas of study. Regulatory status varies by country and intended use.
Storage recommendations for glutathione reagents usually specify a cool, dry, dark environment because the thiol oxidizes in air and light. Solid material is often kept desiccated at low temperature, while solutions are prepared fresh or stored frozen in aliquots. Repeated freeze-thaw cycles can accelerate degradation, and metal ions can catalyze oxidation. Quality control may include purity assays, water content, and identity confirmation. Stability limits are method-specific, so a stated shelf life applies only to defined conditions and packaging.
Laboratory measurement of glutathione requires attention to oxidation before analysis. Blood, tissue, or cell samples can lose reduced glutathione as it converts to GSSG or forms mixed disulfides with proteins. Acid extraction, rapid freezing, and thiol-blocking reagents are common strategies to preserve the original distribution. Reported concentrations therefore depend on collection protocol, extraction method, and the time between sampling and analysis. Comparisons across studies are most reliable when these pre-analytical variables are described.
Ubiquitin-binding domains (UBDs) are modular protein domains that non-covalently bind to ubiquitin, these motifs control various cellular events. Detailed molecular structures are known for a number of UBDs, binding specificity determines their mechanism of action and regulation, and how it regulates cellular proteins and processes.
== List of women chemists == The following list is split into the centuries when the majority of the scientist's work was performed. The scientist's listed may be born and perform work outside of the century they are listed under.
The sans-culottes (French: [sɑ̃kylɔt]; lit. 'without breeches') were the common people of the lower classes in late 18th-century France, a great many of whom became radical and militant partisans of the French Revolution in response to their poor quality of life under the Ancien Régime. The name sans-culottes refers to their clothing, and through that to their lower-class status: culottes were the fashionable silk knee-breeches of the 18th-century nobility and bourgeoisie, and the working class sans-culottes wore pantaloons, or long trousers, instead. The sans-culottes, most of them urban labourers, served as the driving popular force behind the revolution. The word sans-culotte, which is opposed to "aristocrat", seems to have been used for the first time on 28 February 1791 by Jean-Bernard Gauthier de Murnan in a derogatory sense, speaking about a "sans-culottes army". The word came into vogue during the demonstration of 20 June 1792. They were judged by the other revolutionaries as "radicals" because they advocated a direct democracy, that is to say, without intermediaries such as members of parliament. Though ill-clad and ill-equipped, with little or no support from the middle and upper classes, they made up the bulk of the Revolutionary army and were responsible for many executions during the early years of the French Revolutionary Wars. According to Peter Stephen Du Ponceau, secretary and interpreter to Baron de Steuben, Steuben first used the expression sans culottes in 1778: "The Baron loved to speak of that dinner, and of his sans culottes as he called us.
Sources: en.wikipedia.org
== Production == BASF's recent success is characterized by a focus on creating resource efficient product lines after completely abandoning consumer products. This strategy was reflected in production by a re-focus towards integrated production sites. The largest such integrated production site is located in Ludwigshafen employing 33,000 people. Integrated production sites are characterized by co-location of many individual production lines (producing a specific chemical), which share an interconnected material flow. Piping is used ubiquitously for volume materials. All production lines use common raw material sourcing and feed back waste resources, which can be used elsewhere (e.g. steam of various temperatures, sulfuric acid, carbon monoxide). The economic incentive for this approach is high resource and energy efficiency of the overall process, reduced shipping cost and associated reduced risk of accidents. Due to the high cost of such an integrated production site, it establishes a high entry barrier for competitors trying to enter the market for volume chemicals. BASF built a new chemical complex in Dahej, Gujarat at a cost of $100 million. This facility has South Asia's first methylene diphenyl diisocyanate (MDI) splitter for processing crude MDI. BASF has 8 production facilities in India. BASF SE has succeeded in developing a semi-crystalline polyamide that allows light to pass through largely unhindered, known as Ultramid.
Many animals can learn behaviours by imitation, but ants may be the only group apart from mammals where interactive teaching has been observed. A knowledgeable forager of Temnothorax albipennis can lead a naïve nest-mate to newly discovered food by the process of tandem running. The follower obtains knowledge through its leading tutor. The leader is acutely sensitive to the progress of the follower and slows down when the follower lags and speeds up when the follower gets too close. Controlled experiments with colonies of Cerapachys biroi suggest that an individual may choose nest roles based on her previous experience. An entire generation of identical workers was divided into two groups whose outcome in food foraging was controlled. One group was continually rewarded with prey, while it was made certain that the other failed. As a result, members of the successful group intensified their foraging attempts while the unsuccessful group ventured out fewer and fewer times. A month later, the successful foragers continued in their role while the others had moved to specialise in brood care.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
The IDF traces its roots to Jewish paramilitary organizations in the New Yishuv, starting with the Second Aliyah (1904 to 1914). The first such organization was Bar-Giora, founded in September 1907. Bar-Giora was transformed into Hashomer in April 1909, which operated until the British Mandate of Palestine came into being in 1920. Hashomer was an elitist organization with narrow scope, and was mainly created to protect against criminal gangs seeking to steal property. The Zion Mule Corps and the Jewish Legion, both part of the British Army of World War I, further bolstered the Yishuv with military experience and manpower, forming the basis for later paramilitary forces. After the 1920 Palestine riots against Jews in April 1920, the Yishuv leadership realised the need for a nationwide underground defense organization, and the Haganah was founded in June of the same year. The Haganah became a full-scale defense force after the 1936–1939 Arab revolt in Palestine with an organized structure, consisting of three main units—the Field Corps, Guard Corps, and the Palmach. During World War II, many Jews from the Yishuv enlisted in the British Armed Forces. Many of them served in the British Army, culminating in the formation of the Jewish Brigade. These would eventually form the backbone of the Israel Defense Forces, and provide it with its initial manpower and doctrine. Following Israel's Declaration of Independence, prime minister and defense minister David Ben-Gurion issued an order for the formation of the Israel Defense Forces on 26 May 1948.
Sources: en.wikipedia.org
=== Characters === Nathan Byrn: The 17-year-old protagonist. He has straight black hair, olive skin and black eyes. He looks like his father. Raised in a family of White witches, but with a Black witch father, he is a Half Code. He can self-heal extraordinarily fast. Jessica Byrn: Nathan's oldest half-sister who hates him. She later becomes a Hunter. Arran Byrn: Nathan's half-brother, with whom Nathan has a loving relationship. Deborah Byrn: Nathan's half-sister. She (like Arran) loves Nathan. Marcus Edge: Nathan's father, the most feared Black witch of all time. He killed Nathan's siblings' father, among numerous others. His Gift is transforming into animals but he has also stolen Gifts from many other witches by killing them and eating their hearts. Cora Byrn: Nathan's mother, a White witch who died by suicide. Her gift was healing. Gabriel Boutin: A Black witch stuck in the body of a Fain. He helps Mercury to get Nathan to her in order to get his witch body back and later falls in love with Nathan. Annalise O'Brien: A White witch, some months older than Nathan. She runs away from her cruel family. She and Nathan were in love as young teens. Soul O'Brien: The uncle of Annalise and a White witch. Mercury: A powerful Black witch who has stolen the blood of every witch family. Rose: A White witch and Mercury's assistant, who always blushes and giggles. Celia: A White witch, Nathan's mentor with whom he was sent to live. She appears to treat Nathan cruelly and even would lock him in a cage.
=== Reverse CAMP === The reverse CAMP test utilizes the synergetic hemolytic abilities of the CAMP factor produced by Streptococcus agalactiae with the α-toxin produced by Clostridium perfringens. Streaking these two organisms perpendicular to each other on a blood agar plate will yield a "bow-tie" clearing of the blood agar by the hemolytic capabilities of the two organisms' toxins. Incubation requires 24 hours at 37 °C.
== Commercial uses == Under the brand names Equal, NutraSweet, and Canderel, aspartame is an ingredient in approximately 6,000 consumer foods and beverages sold worldwide, including (but not limited to) diet sodas and other soft drinks, instant breakfasts, breath mints, cereals, sugar-free chewing gum, cocoa mixes, frozen desserts, gelatin desserts, juices, laxatives, chewable vitamin supplements, milk drinks, pharmaceutical drugs and supplements, shake mixes, tabletop sweeteners, teas, instant coffees, topping mixes, wine coolers, and yogurt. It is provided as a table condiment in some countries. Aspartame is less suitable for baking than other sweeteners because it breaks down when heated and loses much of its sweetness.
After the Boer War, the British army underwent reform focused on lessening the emphasis placed on mounted units. It was determined that the traditional role of cavalry was antiquated and improperly used on the battlefield in the Boer War, and the First World War was the proof that mounted attacks had no place in twentieth century combat. Cavalry was put to better use after the reforms in the theatres of the Middle East and World War I, and the idea of mounted infantry was useful in times when war was more mobile. An example was during the First World War during the Battle of Mons, in which the British cavalry held the Belgian town against German assault.
Sources: Monocytes; Dendritic cells; Primary T cells; Mast cells; Granulocytes; Macrophages; Adipocytes; Endothelial cells Most complement systems are synthesized by hepatocytes in the liver, however, properdin is synthesized by neutrophils, monocytes, and T cells. Properdin is a positive regulator of the alternative pathway through its mechanism of stabilizing the C3 convertase (C3bBb). Primary T cells, monocytes, macrophages, dendritic cells, granulocytes, and mast cells synthesize mRNA to secrete properdin. Functional properdin is a product of human liver-derived HEP G2 cells. Properdin localized in the granules of neutrophils are released by TNF, TNF/fMLP, PMA, C5a, or IL-8. Additionally, neutrophils promote complement activation upon binding of cytokines, which stabilizes the alternative pathway via release of properdin, increasing defense against microorganisms. Properdin sourced from T cells promote phagocytosis of apoptotic T cells, which is an indication of their function in recognizing and clearing out apoptotic cells. Properdin is also sourced in endothelial cells along with the other complement proteins. Endothelial gene transcripts are induced when shear stress occurs, followed by properdin release into extracellular compartments. Properdin plays an important role in tissue regulation, energy metabolism, and lipid metabolism. An experiment in properdin deficient mice concluded that properdin deficiency results in fat storage and less energy output in comparison to wild-type mice. Properdin regulates fatty acid uptake into adipose tissue.
Sources: en.wikipedia.org
Common methods include spectrophotometric enzyme cycling assays, HPLC with UV or fluorescence detection, and LC-MS/MS. Detection often requires derivatization because glutathione lacks a strong chromophore. Method choice depends on the sample type and the required sensitivity.
Yes, especially in solution or when exposed to oxygen, light, and heat. The reduced form can oxidize to GSSG or form disulfides with other thiols. Powdered material stored cool and dry is generally more stable than aqueous preparations.
Purity refers to the proportion of the intended compound in a sample, often determined by chromatography. A high purity value does not necessarily indicate a specific oxidation state. Buyers may also need information about GSSG content, water, and residual solvents.
Acidification lowers pH and helps prevent oxidation of the thiol group during extraction and storage. It can also precipitate proteins and stabilize the reduced form before analysis.